| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MNPQPPSEQPQQPPPTLTNPRFTLELEFVSSLANPYYLSHLAVNYPNLLGISRTSEESDLNNDTVDPEAQAFAAYLAYLYSYWKTPEYAQFLTHPGATLRALRLLQEDAFRRDIIRPQVIEYLAGVGLDANQEGATGEAGEQREGEQAQDSQENQAQVGDKAVKT |
| Length | 165 |
| Position | Middle |
| Organism | Aspergillus steynii IBT 23096 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus> Aspergillus subgen. Circumdati. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.650 |
| Instability index | 46.97 |
| Isoelectric point | 4.44 |
| Molecular weight | 18385.00 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP17086
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.76| 18| 35| 24| 41| 1
---------------------------------------------------------------------------
24- 41 (31.06/15.78) LELEFVSSLANPY..YLSHL
60- 79 (26.70/12.83) LNNDTVDPEAQAFaaYLAYL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EQREGEQAQD 2) QENQAQVGD | 141 152 | 150 160 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab