<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17062
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASSVSLRAGPPSPSSPAAGSLKETQPSIPVSDQIPQTPTSPPLMSVSAQNYASNFTSSQASPNQQTTSQPANVSSPPSSAPMSTQPSQQPVVGPPQSFPTPASSVSGQFPGPSSADDADHADKSVSSAMPDAAALTDASTPHADNRRTDHERQLGGPGDAMDIDTDGALGRISSLDSLQKEFSSAYHLCKSSHVTPGPDPSIDLVSLYGLGPVAKSVARMDPITGEKINRLRKSYEGKLKGLGLAGRNKPVKQEPGAPGGLRHMTLWPEEEWQNQKVYGKDIKIADMDSALHNLQMKAMRMEPGAVPNNDYWEDVLGHEKPSKHGGAEAGKKTTAAPSAPSGARGPNSANGTPTADADRNRPSRGRKRHYDENSFVGYGEGFADDDDEGAFNSNGEGVGKKKRKKDHVSKISTPHPDRGGSYGVGIYGIGAR |
| Length | 436 |
| Position | Head |
| Organism | Aspergillus candidus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.825 |
| Instability index | 46.07 |
| Isoelectric point | 6.64 |
| Molecular weight | 45775.82 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP17062
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 192.44| 43| 44| 112| 154| 1
---------------------------------------------------------------------------
15- 64 (46.10/15.43) .PSPS.S.PAAGS..........LKETQPS..IPvsDQIPQTPTSPPlmsvSAQNYASNFtsSQA
65- 94 (49.13/16.89) SPNQQ.T.TSQPA..........N..VSSP...P..SSAPM...STQ....P.......S..QQP
115- 159 (68.86/26.40) GPSSA.D.DADHA..........DKSVSSA..MP..DAAALTDASTP....HADNRRTDHerQLG
160- 207 (28.35/ 6.87) GPGDAmDiDTDGAlgrissldslQKEFSSAyhLC..KSSHVTPGPDP....SID...........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 189.10| 45| 46| 340| 385| 2
---------------------------------------------------------------------------
307- 338 (49.45/22.89) ....P.GAV.PN..NDYWEDVLGHEKPS....KHGGA.EA...G.KKTT
340- 385 (76.49/43.17) APSAPSGARGPNsANGTPTADADRNRPSRGRKRHYDE.NSF.VG.YGEG
387- 434 (63.16/31.30) ADDDDEGAFNSN.GEGVGKKKRKKDHVSKISTPHPDRgGSYgVGiYGIG
---------------------------------------------------------------------------
|