Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDAQFQSTLSNLENRLNALISSLTTSPTAAGAPAAALNLLEADDALTSDIATLRQHQENYARILKLREESASLEEKVKDIVREVVRHEKDIQTACGGDVYDDSDDSSDYEDDVSGAPGKPARGRTMREIDYKLLLDFARRISKYNHQAAADAAAGAPAKPRPQIQQAQEPADTEMTGMNSHGGAGATGTEEGVAPVASVTKDATSWLDESANMTRQVYMLPYPMEDRIRMGLMGQIQLASGEGKPDFDADKEVERLIREAEGLGTAGAVPPAAEMGEATRHAEEAAKAAAHAGVAATSGRAAVAAAPAPKPKAMLDLDLYDPDEDDE |
Length | 327 |
Position | Middle |
Organism | Aspergillus candidus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.536 |
Instability index | 37.38 |
Isoelectric point | 4.58 |
Molecular weight | 34776.06 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP17054 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 39.58| 10| 38| 111| 120| 1 --------------------------------------------------------------------------- 111- 120 (20.39/10.55) DDVSGAPGKP 151- 160 (19.19/ 9.53) DAAAGAPAKP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 37.82| 11| 14| 268| 278| 4 --------------------------------------------------------------------------- 268- 278 (19.98/10.07) AVPPAAEMGEA 285- 295 (17.85/ 8.25) AAKAAAHAGVA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AKAAAHAGVAATSGRAAVAAAPAPKPKAMLDLDLYDPDEDDE 2) GRTMREIDYKLLL | 286 123 | 327 135 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab