<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17047

Description C/H/G cyclin
SequenceMAANFWTSTHGTNWLLSRQALADCRKIDRQYVNEQDLIKVNIWFAQIITDLGRSLQVRQVIIATAITYFKRFYTKNSFRNTEPNLVAATCMYLACKIEESPQHIKAIITDMKTIMQERGEHFTYDNQKVAEMEFYLLEELDFNMIVYHPYRSLMTLAQDLGTKNEDVQWAWYVINDSYRTDMCLLYPPHVVAAAALYLRIALRGGAQYGDYSLTSTTSTANDNSVAGVTTRGAKRGAAAAASNNNTNTTANETPKVKDIRLWFAQLNVDLEHISDIVQEIISLYKLWGEEDKQNEKIREILTRLLK
Length306
PositionKinase
OrganismRhizophagus irregularis
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina> Glomeromycetes> Glomerales> Glomeraceae> Rhizophagus.
Aromaticity0.10
Grand average of hydropathy-0.297
Instability index34.38
Isoelectric point6.33
Molecular weight35116.57
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17047
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.03|      28|     167|      76|     138|       1
---------------------------------------------------------------------------
   76-  103 (51.86/78.92)	NSFRNT.....EPNLVAATCMYLACKIEESPQH
  176-  208 (43.16/12.17)	DSYRTDmcllyPPHVVAAAALYLRIALRGGAQY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     100.27|      30|     216|      33|      62|       2
---------------------------------------------------------------------------
   33-   62 (52.02/35.98)	NEQDLIK.VNIWFAQIITDLGRSLQVRQVII
  251-  281 (48.25/32.91)	NETPKVKdIRLWFAQLNVDLEHISDIVQEII
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17047 with CycC domain of Kingdom Fungi
Unable to open file!