<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17019

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMIEPSQNMTSPVQWGTFFHQCLIHRIDASEFRNLSKLLMQKCPIAETGLLDALLQTRSESRIKWDPLLPLYIDCLCRMGRVRTSTVLTSLLKYSSIHDKPQLPTSEGKDGSKCYTLMTDIRVIQDAMLSVSTGSTPKTNAEAIAIFFSIIDWIRAVVSWHNSHFDPGQHSSGMMSSPDVVSLFESLGILLAALSGTGKGLEVLSADSHEGLKVKLGQALSAYLPLCVEVSLPLRNRLDGLQKEFNLYGERAPKSLDVPMMENMNVNALQFEASVMDGPVINSRAGLYVFINAMLVGRPLVDDGMLINYLANRYGGHYEALIEEILTAAFDVLSNGMYRNESSRTMFVFRSFLVNKLPAFFAAMLASTMVSIPMEMCISHALSRLDPNTFPSFSQMFEMQGNTVLSDVRQEFLFACASHKLIPESSIERLLGENPMQTLPVGYNKDELVSQINANPERAEQLINEIESMEGNAGPIIGAITEVMHNLCNQKESMTLKNICNSLSRRPQALDVVLIFRNPKQVLQPLCALLDSWHWDEDQGENQPVYDEFGSILLLVLAFKYRFDLRPADLGISSNDSFVLRLLERGSCSQKLDALDEKQNKNLGSWIAALFIAEGISEETMSACSPQEFYLLVATLFSQSLEACETGKLEFDTLKGGFEYLLEPFLLPSLIFALTWLGNHIWETELDPSIPLKALHSLVNPSSISGEAREIHRTVLNITARTLEEPLKDVRTRHPSRTDIKPILDSLEPCLSFQRVGSSHRSELEGWTTHSGGGLLGSIRSTFQSLVLWSTNPEVSMAPPPYTHRQLIAGVRMLGASRVLPALIEELKLQTEAGNGPLAQDLAATLICAPMAETFSVEQNSHQPVDPNKEALPRCGILTLRDVLALQHENVPKISEKDPLRAEVIVRLYRRVNALLAPPSQVPNLDVNNIIQNMQLGVPDGAGCRGAADHGVGPDDAENIHRMIDNAAAAAGLDSSGTGLDTSIDDVLNAADMAVGNPEFLDLDMEGMF
Length1008
PositionTail
OrganismAspergillus novofumigatus IBT 16806
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.07
Grand average of hydropathy-0.048
Instability index45.75
Isoelectric point5.03
Molecular weight111180.19
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17019
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     123.97|      31|     297|     520|     553|       1
---------------------------------------------------------------------------
  520-  553 (46.48/39.19)	QVLqPlcALLDSWHWDEDQGENQPVYDEFGSILL
  763-  787 (32.67/16.20)	.........LEGWTTHSGGGLLGSIRSTFQSLVL
  817-  846 (44.82/26.18)	RVL.P..ALIEELKLQTEAG.NGPLAQDLAATLI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      94.84|      25|     619|     249|     294|       2
---------------------------------------------------------------------------
  256-  280 (44.13/25.50)	DVP.MMENMNVNAL..QFEASVMDGPVI
  881-  904 (36.01/ 9.43)	DVL.ALQHENVPKI..S.EKDPLRAEVI
  918-  940 (14.70/12.64)	..PsQVPNLDVNNIiqNMQLGVPDG...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     151.93|      43|     230|     329|     439|       6
---------------------------------------------------------------------------
  384-  426 (76.06/132.22)	LDPNTFPSFSQMFEMQGNTVLSDVRQEFLFACASHKLIPESSI
  661-  703 (75.88/20.01)	LEPFLLPSLIFALTWLGNHIWETELDPSIPLKALHSLVNPSSI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.22|      20|     674|     314|     346|       7
---------------------------------------------------------------------------
  284-  305 (30.08/34.35)	AGLYVFINAMLvgRPLVDDGML
  327-  346 (35.14/15.32)	AAFDVLSNGMY..RNESSRTMF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17019 with Med5 domain of Kingdom Fungi
Unable to open file!