<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17010
Description |
Mediator of RNA polymerase II transcription subunit 27 |
Sequence | MMIPAAGPVAASSQQNTQDPADTTAEAPPKQVATAMERLSRAARLIADVRIGADRLLEALFLAAESPYQSNKSIQLVLKEESAMRKHFQDLRSLGKQLEDSGVLNGSVKLRGNSWGLHMPLVCPDGAVVAYAWKRQLAGQAGASAVDRTRLALKAFTDQKRRFFPHLEDEAFTQCSEGELGVAKKPCFSHGLLPGHKDELREERTLPDIINSLQCIAPDIKIYTYQRLDWLKRASSLSSLPSDHLVDSSNEYGLQSSSNSTSVLGNAASISEDQVAVIELLSPSVFRAVVSLHPTGSMSPDAVAFFSTDEGGSYVHARGRSVFHVFWHVTEYADKALQYFQSTNVDTSLSLILVLLIPD |
Length | 359 |
Position | Tail |
Organism | Dendrobium catenatum |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.180 |
Instability index | 44.87 |
Isoelectric point | 5.95 |
Molecular weight | 39166.85 |
Publications | PubMed=26754549
PubMed=28902843
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP17010
No repeats found
|