<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17008
Description |
Mediator of RNA polymerase II transcription subunit 28 |
Sequence | MEAAKKLQLYFISLQHEDQPTKEEMLRKEISIMEDELKTKSELIKKHENRIEAWREELKEQLDRHTAELQRV |
Length | 72 |
Position | Head |
Organism | Dendrobium catenatum |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.103 |
Instability index | 53.19 |
Isoelectric point | 5.63 |
Molecular weight | 8790.97 |
Publications | PubMed=26754549
PubMed=28902843
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP17008
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.80| 18| 19| 21| 38| 1
---------------------------------------------------------------------------
12- 29 (29.46/13.73) ISLQHEDQPTKEEMLRKE
30- 47 (29.35/13.66) ISIMEDELKTKSELIKKH
---------------------------------------------------------------------------
|