<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP17000

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQGHAQAIVPSPARLGLSKATSPSLPSQAPNPNPNPNPNLKPTPFSASSTSAPVTTSSSLLSLLPPLPRAQSLLLQMALLSGKLFEVSPHRALWASARAGGPPTFLPGAQSQPLSLDPRHPSPPTTTKEVLSLFTSFQTQLFESVAELQEILDLQESKLKIAREIRNKDSTLLAFTRKLHEAEQVLDHLLDDYSDYRRDPKRLKGEPGEADYQSSLHSSLDLNEVLAYAHRISYTTFAPPEHGAGMAPLRGALPPAPQDNEMRASQLYHFADLDVGVPKKAPEGKEGAAEKITESLIEPTPPREEAPLHIPPPMLPITVPPGWKKGMPVELPLELPLVPPGWKPGDPVPLPPLEGVVVVNKGDEQRVGGVPLLSGLLLPQPKAPEPIQVKYVQLDINPDQDEYSSDYSSEVGSSEEDDEE
Length421
PositionMiddle
OrganismDendrobium catenatum
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae> Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
Aromaticity0.05
Grand average of hydropathy-0.434
Instability index62.15
Isoelectric point5.08
Molecular weight45563.12
Publications
PubMed=26754549
PubMed=28902843

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP17000
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      84.44|      16|      18|     320|     335|       1
---------------------------------------------------------------------------
  240-  251 (19.05/ 6.09)	.PPEHGAGMA....PLR
  320-  335 (34.57/17.36)	VPPGWKKGMPVEL.PLE
  339-  355 (30.82/14.64)	VPPGWKPGDPVPLpPLE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     140.60|      31|      32|      11|      41|       2
---------------------------------------------------------------------------
   11-   41 (57.45/24.35)	PSPARLGLSKA...TSPSLPSQAPNPNPNPNPNL
   43-   75 (43.87/16.87)	PTPFSASSTSApvtTSSSLLSLLP.PLPRAQSLL
   90-  114 (39.28/14.34)	PHRALWASARA...GGP..PTFLPGAQSQP....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     133.78|      41|      79|     276|     318|       3
---------------------------------------------------------------------------
  276-  318 (64.44/38.35)	VGVPKKAPEGKEGAAEKITeSLIEPTPPREEaPLHIPPPMLPI
  357-  397 (69.34/34.10)	VVVVNKGDEQRVGGVPLLS.GLLLPQPKAPE.PIQVKYVQLDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      93.86|      22|      35|     133|     154|       4
---------------------------------------------------------------------------
  133-  154 (34.32/26.40)	SLFTSFQTQLFESVAELQEILD
  171-  192 (33.03/25.11)	STLLAFTRKLHEAEQVLDHLLD
  208-  227 (26.52/18.61)	PGEADYQSSLHSSL.DLNEVL.
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP17000 with Med4 domain of Kingdom Viridiplantae
Unable to open file!