| Description | Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MDIISQLQEQANSIALIALNTFGTLQRDAPPVRLSPNYPEPPANPSEETINITEQPKTMSAALVQAAKKFDALIAALPLEGGEEAQLKRIAELQAENELVGLELQKQLEAAAEQELKLVQALFSQASDNCLNLKKPD |
| Length | 137 |
| Position | Middle |
| Organism | Dendrobium catenatum |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae> Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium. |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.268 |
| Instability index | 63.10 |
| Isoelectric point | 4.49 |
| Molecular weight | 14873.74 |
| Publications | PubMed=26754549 PubMed=28902843 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP16995
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.46| 26| 28| 79| 106| 1
---------------------------------------------------------------------------
79- 106 (37.84/26.28) LEGGEEAQLKRIAEL..QAENElvGLELQK
108- 135 (37.62/20.60) LEAAAEQELKLVQALfsQASDN..CLNLKK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) AQLKRIAEL 2) EETINITE 3) MSAALVQAAKKFDALIA 4) SPNYP | 85 47 59 35 | 93 54 75 39 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab