Description | Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MDIISQLQEQANSIALIALNTFGTLQRDAPPVRLSPNYPEPPANPSEETINITEQPKTMSAALVQAAKKFDALIAALPLEGGEEAQLKRIAELQAENELVGLELQKQLEAAAEQELKLVQALFSQASDNCLNLKKPD |
Length | 137 |
Position | Middle |
Organism | Dendrobium catenatum |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae> Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.268 |
Instability index | 63.10 |
Isoelectric point | 4.49 |
Molecular weight | 14873.74 |
Publications | PubMed=26754549 PubMed=28902843 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP16995 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 75.46| 26| 28| 79| 106| 1 --------------------------------------------------------------------------- 79- 106 (37.84/26.28) LEGGEEAQLKRIAEL..QAENElvGLELQK 108- 135 (37.62/20.60) LEAAAEQELKLVQALfsQASDN..CLNLKK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AQLKRIAEL 2) EETINITE 3) MSAALVQAAKKFDALIA 4) SPNYP | 85 47 59 35 | 93 54 75 39 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab