<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16994
Description |
Mediator of RNA polymerase II transcription subunit 30 |
Sequence | MAGKSTLELGVEGQRHLEETINAAFQILSSMNDELCNPVLWATSSVSHGGSVNVTATQFPAGGGETSSEMSSHTPDAGGSGGGLGGFGGAGGGALDEARLRYKTAVASLRAVLAAIPSSSQENGALEAKVDQVEIERLEERCAVLRKELADKNKHLKLLIDQFRNLVADVSMWNSPFSV |
Length | 179 |
Position | Head |
Organism | Dendrobium catenatum |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.170 |
Instability index | 42.07 |
Isoelectric point | 5.08 |
Molecular weight | 18712.71 |
Publications | PubMed=26754549
PubMed=28902843
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16994
No repeats found
|