| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MDSSKEDADRPTESPSAPKHPYKDPDDGRQRFLLELEFVQCLANPAYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNANFRNAMAHPGSKELAHRQQYFFWKNYRYNRLKHIAPRPLPEAAVAPPPTPPAPMPPMPVASAPTLPPMQVVGQPGSAPPKVDMRNSMVDRRKRKKEG |
| Length | 193 |
| Position | Middle |
| Organism | Dendrobium catenatum |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae> Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium. |
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.746 |
| Instability index | 54.51 |
| Isoelectric point | 9.26 |
| Molecular weight | 22474.58 |
| Publications | PubMed=26754549 PubMed=28902843 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP16991
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.83| 14| 23| 97| 110| 1
---------------------------------------------------------------------------
97- 110 (25.91/15.03) NFR.NAMAHPGSKEL
121- 135 (21.92/11.76) NYRyNRLKHIAPRPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.83| 12| 25| 136| 147| 2
---------------------------------------------------------------------------
136- 147 (24.59/10.12) PEAAVA..PPPTPP
162- 175 (20.24/ 7.18) PPMQVVgqPGSAPP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) NYRYN 2) PKVDMRNSMVDRRKRK | 121 175 | 125 190 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab