<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16979
Description |
Mediator of RNA polymerase II transcription subunit 9 |
Sequence | MDHHFGLGSWMMVPTQNTIPHDHSSLQAQYYQQQQQQQQHLLPQQLQQQHQEHQDHNHHQSLASHFHLLHLAESLAEAVGSGTRDQQSEALMNELANHFDKCQQLLNSILGSITTKAMTVEGQKRKQEETKLLLNQRKELIAKYRSSVEELLNADLSR |
Length | 158 |
Position | Middle |
Organism | Dendrobium catenatum |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.887 |
Instability index | 54.71 |
Isoelectric point | 6.24 |
Molecular weight | 18256.12 |
Publications | PubMed=26754549
PubMed=28902843
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16979
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.19| 12| 14| 29| 40| 1
---------------------------------------------------------------------------
29- 40 (24.30/ 8.62) QYYQQQQQQQQH
45- 56 (23.89/ 8.37) QLQQQHQEHQDH
---------------------------------------------------------------------------
|