<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16971
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MTVKWLMHWQPKPGTTLSTQILTEACQCVESIGGQKDGRWRSVLTFYKPMQRDALVPVDHPRDFLGLALQEQPAKYYFILRPNRIVLEADASIQVIMEKLQSYKARVTLNFEGFQYKLGDFQLRVGKCVPSASEALRGIMMEVEYIPLSSIDKSRQVLEEFFDIWQETISKKSLPGHFMHIESNFADYGLQDRYTSHHTAVQYATCMAQLIAAVRC |
Length | 216 |
Position | Head |
Organism | Dendrobium catenatum |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.211 |
Instability index | 48.45 |
Isoelectric point | 7.66 |
Molecular weight | 24843.44 |
Publications | PubMed=26754549
PubMed=28902843
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16971
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.86| 14| 15| 129| 142| 1
---------------------------------------------------------------------------
129- 142 (23.53/14.41) VP.SASEALRGIMME
146- 160 (18.33/10.05) IPlSSIDKSRQVLEE
---------------------------------------------------------------------------
|