<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16963
| Description |
Putative mediator of RNA polymerase II transcription subunit 26a |
| Sequence | MEMAEAKGSLDYWRKLLNSATSDIFELINKAILVAAEDFPNEFKERREMIAEKLYTCHLSLNNGDAESLKEVKKNSNSDNPEENDQIVGEVMRIKEVILSNNQLHEPEYDYILYESLRTLQQMQLSVDVLKTTKIRRTVRATLKHCSSRIRKLARCLINSWRVLGDERVNSAAKITNKSTTNFSLGCSSKQTSEQKPTSRSSAGVKRKQSD |
| Length | 211 |
| Position | Unknown |
| Organism | Dendrobium catenatum |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.678 |
| Instability index | 37.09 |
| Isoelectric point | 8.97 |
| Molecular weight | 24089.09 |
| Publications | PubMed=26754549
PubMed=28902843
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16963
No repeats found
|