<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16958

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMEAVGGATAAPEQQQPAPTPSKAERLNLAVQQQLNLESVKARALGLSKAISRILEDFNAIALTNATPKWQDILGQFSMVNMELFNIVEDIKKVSKAFVVHPKNVNAENALILPVMLSSKLLPEMEVEDNAKREQLLSGMANLPIPTQMEKLKVRIDMISAACETAEKVIADTRKAHGLGSRQGPTLVPTLDKVQAAKIQEQENQLRAAVNFGEGLRVTGDQRHLPSSLPPHLVDVLASGDGAHNFGETGIDFHSYATCNICLSPLRLPDLWTATCNVGEHLLTASIKYWELWTTAYGLQGYKTARHLAGTQGQPAGITGAREENVGKSLGGDGWAGTGVFSKSTPSFSSNSINPQGGLMQTTGGQMIGRSVPSPSGVSSSFDNASTPPPPYANSPRSGGNIMNTPSPQQQTQQQQQQQQQRQKMMQMPQHQQQLLAQQQLRQPSSTAILAQPLVASKLLVVGYGCSIRLIAGRRSLNGATPGVETIQFSNKWFLAVWIGGCGDVISHWFLGHAASGDPHGCWILLCGTMTQLHDLQGQGQQKFQPVPGQHQMQYSQPLSQQFQNRQLQSAHIQHNIAQSQITQGGQLRNQLSQFTGSANSALFNAAQTSPNSQMFGLSGGHPQRNLQSQILNDQMFGMGGSNTASMVGMQPQQHGAQGGFGFNNASNPVNANVSYDGNNVDILNILDNCVTPSLLLAPSINKGVDIVDFGGETDKVVELGPSVDYANLAAPLVDAVQLDSVLPLASPFSVEAVADIGVSIEFVRTGSIECAYVNVLVPLISPEALKAHLAINLEGAYMVHNDWLDGSTSSACVGDREDLDGLKEEDHKLYNLRVSRIVEKAFGLGGGKRHRRKHKKK
Length857
PositionHead
OrganismDendrobium catenatum
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae> Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
Aromaticity0.05
Grand average of hydropathy-0.293
Instability index49.97
Isoelectric point6.65
Molecular weight92215.25
Publications
PubMed=26754549
PubMed=28902843

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16958
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.18|      17|      18|     256|     272|       1
---------------------------------------------------------------------------
  256-  272 (34.54/23.85)	ATCNIC....LSPLRLPDLWT
  273-  293 (28.65/18.53)	ATCNVGehllTASIKYWELWT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      84.88|      18|      18|     372|     389|       2
---------------------------------------------------------------------------
  341-  355 (19.65/ 7.40)	.SKS..TPSFSSNSINPQ
  372-  389 (33.97/17.87)	PSPSGVSSSFDNASTPPP
  390-  407 (31.25/15.88)	PYANSPRSGGNIMNTPSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      72.70|      17|      18|     611|     628|       3
---------------------------------------------------------------------------
  611-  624 (22.95/10.46)	.......NS.QMFGLSGGHPQR
  625-  645 (26.25/15.23)	NLQsqilND.QMFGMGGSNTAS
  648-  663 (23.50/11.25)	GMQ......pQQHGAQGGFGFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     105.08|      15|      17|     408|     422|       4
---------------------------------------------------------------------------
  408-  422 (29.08/11.30)	QQQTQQQQQ...QQQQRQ
  425-  442 (27.06/10.08)	MQMPQHQQQllaQQQLRQ
  552-  566 (26.03/ 9.47)	MQYSQPLSQ...QFQNRQ
  579-  593 (22.91/ 7.59)	SQITQGGQL...RNQLSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.95|      16|      17|      13|      28|       5
---------------------------------------------------------------------------
   13-   28 (28.90/18.15)	QQQPAPTPSKAERLNL
   31-   46 (26.06/15.63)	QQQLNLESVKARALGL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.50|      12|      32|     208|     223|       6
---------------------------------------------------------------------------
  208-  223 (18.96/22.49)	AVNFGEglrvTGDQRH
  242-  253 (25.55/16.64)	AHNFGE....TGIDFH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      61.32|      21|      23|     698|     719|       7
---------------------------------------------------------------------------
  698-  719 (31.48/27.07)	PSI...NKGVDIVDfGGETDKVVEL
  721-  744 (29.84/19.48)	PSVdyaNLAAPLVD.AVQLDSVLPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.42|      12|      34|     746|     761|       8
---------------------------------------------------------------------------
  746-  758 (15.24/17.76)	SPFSVEaVADIGV
  764-  775 (20.17/ 7.01)	RTGSIE.CAYVNV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.83|      15|      34|     464|     482|       9
---------------------------------------------------------------------------
  473-  504 (17.39/11.94)	RRSLNGATPGvetiqfsnkwflavwigGCG.DV
  507-  525 (22.44/ 8.98)	HWFLGHAASG..............dphGCWiLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      44.48|      15|      18|     302|     319|      10
---------------------------------------------------------------------------
  302-  319 (14.77/18.68)	KTARHLAGtQGQpAGiTG
  324-  338 (29.72/15.57)	NVGKSLGG.DGW.AG.TG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.22|      12|      18|      53|      64|      11
---------------------------------------------------------------------------
   53-   64 (20.17/11.83)	ILEDFNAIA..LTN
   72-   85 (17.05/ 8.95)	ILGQFSMVNmeLFN
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16958 with Med8 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LAGTQGQPAGITGAREENVGKSLGGDGWAGTGVFSKSTPSFSSNSINPQGGLMQTTGGQMIGRSVPSPSGVSSSFDNASTPPPPYANSPRSGGNIMNTPSPQQQTQQQQQQQQQRQKMMQMPQHQQQLLAQQ
307
438










Molecular Recognition Features






MoRF SequenceStartStop




1) GKRHRRKHKKK
847
857