<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16956
| Description |
Mediator of RNA polymerase II transcription subunit 19a |
| Sequence | MELDQLFQNASYLREPSTIQPFDLDTLGQAFQLQETAPIDLSSADKGIPTSSGKSKESKNKSKKHKKHKEKDKEKDKEHKKHKHRHKDKSKDKDKEKKKEKSGHHDSGGDHSKKHHDKKRKLEGSEDITDAHKHKKSKVEEKFSSRLGISA |
| Length | 151 |
| Position | Head |
| Organism | Dendrobium catenatum |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -1.788 |
| Instability index | 40.88 |
| Isoelectric point | 9.63 |
| Molecular weight | 17352.20 |
| Publications | PubMed=26754549
PubMed=28902843
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16956
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.42| 21| 21| 68| 88| 1
---------------------------------------------------------------------------
68- 88 (39.84/12.20) HKEKDKEKDKEHKKHKHRHKD
90- 110 (34.58/ 9.69) SKDKDKEKKKEKSGHHDSGGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.32| 13| 20| 2| 21| 2
---------------------------------------------------------------------------
2- 15 (18.92/31.86) ELDQLFQnASYLRE
23- 35 (23.40/11.23) DLDTLGQ.AFQLQE
---------------------------------------------------------------------------
|