<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16953
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MFQRIVRVLELAGLVMDELANSTGPRTEVLAGHCREFMKSIKVFLREYLCVSEALGMLICPRWELLCSNGGD |
| Length | 72 |
| Position | Head |
| Organism | Dendrobium catenatum |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Epidendroideae> Malaxideae> Dendrobiinae> Dendrobium.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.296 |
| Instability index | 20.28 |
| Isoelectric point | 5.75 |
| Molecular weight | 8117.54 |
| Publications | PubMed=26754549
PubMed=28902843
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16953
No repeats found
No repeats found
|