<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16951
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MAQTLPPEHVKAIDLLRMRLAGLSTSIAFLSEALAAPQNDPLLAWPELQKASSNIGQHLDSLASALSAQRQLFTLLHLHPLPNFPGHTQKDLLAQLVRKKLDPNAQAWIEESVKISKERSNGVVASPETGTMTVDGMKDLWSSAVDIQQEVLAPWMDQELFGDVFTAQERENGVKNVVTGLKRDLAAEDDEDEDGNGDQMVEDAASPDAVQASAANGLNASLAPLSLDSMLKFAHGQDIS |
| Length | 240 |
| Position | Head |
| Organism | Cercospora zeina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.263 |
| Instability index | 37.27 |
| Isoelectric point | 4.57 |
| Molecular weight | 25908.81 |
| Publications | PubMed=29242781
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16951
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.27| 24| 41| 20| 60| 1
---------------------------------------------------------------------------
22- 52 (36.14/40.96) GLSTSIAFLSealaapqNDPLLAWPELQKAS
217- 240 (42.13/13.33) GLNASLAPLS.......LDSMLKFAHGQDIS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.74| 16| 49| 108| 123| 4
---------------------------------------------------------------------------
108- 123 (28.50/20.46) WIEE....SVKISKERSNGV
155- 174 (25.23/17.42) WMDQelfgDVFTAQERENGV
---------------------------------------------------------------------------
|