| Description | Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MREYLLYSQIPAAREEQVLSILAGISRNQPTPINEQILLYAQLKAPAAVVSKKQPQPKTTVTQPLSYHRLIRSFDVDGGTATNVQPWTFRAESIPDTGITTYISRTTTSQLATPDQLSLLKQPQFYHLKRQYIQSGSRFIHHNLIIKVVRFYSNPPETTAATTTPPQAPQDPLSETSPPKNTSQLKLVDASGSFIIEVSIRVEDPTNSSLTEAALGELMRFKSTLDGAIDLIAPDRFLLDTRVKGNPMGVAAGA |
| Length | 254 |
| Position | Head |
| Organism | Cercospora zeina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.300 |
| Instability index | 41.41 |
| Isoelectric point | 9.07 |
| Molecular weight | 27985.52 |
| Publications | PubMed=29242781 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP16948
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 113.84| 37| 55| 100| 140| 2
---------------------------------------------------------------------------
100- 140 (53.55/45.62) TTyiSRTTTSQLATPDQLSLLKQPQ.FYHLKrQYIQSGSrFI
158- 195 (60.29/35.05) TT..AATTTPPQAPQDPLSETSPPKnTSQLK.LVDASGS.FI
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LSYHRLIR 2) MREYLLY | 65 1 | 72 7 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab