Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MREYLLYSQIPAAREEQVLSILAGISRNQPTPINEQILLYAQLKAPAAVVSKKQPQPKTTVTQPLSYHRLIRSFDVDGGTATNVQPWTFRAESIPDTGITTYISRTTTSQLATPDQLSLLKQPQFYHLKRQYIQSGSRFIHHNLIIKVVRFYSNPPETTAATTTPPQAPQDPLSETSPPKNTSQLKLVDASGSFIIEVSIRVEDPTNSSLTEAALGELMRFKSTLDGAIDLIAPDRFLLDTRVKGNPMGVAAGA |
Length | 254 |
Position | Head |
Organism | Cercospora zeina |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.300 |
Instability index | 41.41 |
Isoelectric point | 9.07 |
Molecular weight | 27985.52 |
Publications | PubMed=29242781 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16948 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 113.84| 37| 55| 100| 140| 2 --------------------------------------------------------------------------- 100- 140 (53.55/45.62) TTyiSRTTTSQLATPDQLSLLKQPQ.FYHLKrQYIQSGSrFI 158- 195 (60.29/35.05) TT..AATTTPPQAPQDPLSETSPPKnTSQLK.LVDASGS.FI --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LSYHRLIR 2) MREYLLY | 65 1 | 72 7 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab