<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16942
| Description |
RNA polymerase II holoenzyme cyclin-like subunit |
| Sequence | MAANYWDSTQAKFWTFTKDELADTRKELQRANQALHHKYALPERRHMNIYFQQQLTKLARRMSLRQQALATAQMYMKRFYLRVEIRKTNPYLIMATAVYLACKMEECPQHIRLMLGEAARQWPELGVSESSKIGECEFALISTLSSRLICHHAYRPLNEFAQIFGLSTEESNLAHSIVNDVFLTDLVLLYPPHVLAVTALVLAVVLRPSGQPPGLQAHSAHGPLGQTSPTVGSPTSASAPGFPPGMNAAAAQQAFLGTFSGLRQAGPKLSKIVDWLAESKIDVPAVIDSTQEMISLYAVWEESYNERACKEAITRFVKDGGAWSSGATSK |
| Length | 330 |
| Position | Kinase |
| Organism | Cercospora zeina |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Cercospora.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.169 |
| Instability index | 56.91 |
| Isoelectric point | 8.72 |
| Molecular weight | 36684.70 |
| Publications | PubMed=29242781
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16942
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.14| 19| 29| 210| 228| 1
---------------------------------------------------------------------------
210- 228 (38.08/22.94) GQPPGLQAHSAHGP.LGQTS
241- 260 (32.05/18.25) GFPPGMNAAAAQQAfLGTFS
---------------------------------------------------------------------------
|