<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16928
| Description |
"Cyclin C, transcript variant X4 (Fragment)" |
| Sequence | QEILCQEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
| Length | 191 |
| Position | Kinase |
| Organism | Columba livia (Rock dove) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Columba.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.169 |
| Instability index | 51.73 |
| Isoelectric point | 5.45 |
| Molecular weight | 22297.71 |
| Publications | PubMed=23371554
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16928
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 123| 136| 1
---------------------------------------------------------------------------
123- 136 (20.63/21.28) QW..FAELSvDMEKIL
148- 162 (20.73/15.24) QWknFDERK.EMATIL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.43| 20| 27| 47| 68| 3
---------------------------------------------------------------------------
47- 68 (34.97/26.33) EFYLLELmdCCLIVYHPYRPLL
77- 96 (37.46/21.57) EDMLLPL..AWRIVNDTYRTDL
---------------------------------------------------------------------------
|