<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16922
Description |
Mediator complex subunit 28 |
Sequence | MVLLSLLRLFAVELGGRQPVARAALRETGPGLAAALRSPGGPDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLAKLRHWQQVLEDISVQHKKPAEMPQGPLVYLEQASATIPAPMKQT |
Length | 175 |
Position | Head |
Organism | Columba livia (Rock dove) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Columba.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.306 |
Instability index | 57.22 |
Isoelectric point | 5.96 |
Molecular weight | 19587.31 |
Publications | PubMed=23371554
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16922
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.82| 18| 30| 92| 110| 1
---------------------------------------------------------------------------
92- 110 (24.79/16.03) FLQKRLQlSVQKPEQVIKE
125- 142 (31.04/16.25) LIQKHLA.KLRHWQQVLED
---------------------------------------------------------------------------
|