<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16913
| Description |
Mediator complex subunit 22 (Fragment) |
| Sequence | LLQSYNKRLKDDVKSILDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAINQRNQQLRSLQEECDKKLIALRDEISIDLYELEEEYYSSSYSLCDSNDLPLCEAYWRQDFATLSPESLSMPLTAAAAEQSVATSQSSTPSHPHVNGHGAGPVEHS |
| Length | 190 |
| Position | Head |
| Organism | Columba livia (Rock dove) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Columba.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.553 |
| Instability index | 67.03 |
| Isoelectric point | 4.68 |
| Molecular weight | 21381.47 |
| Publications | PubMed=23371554
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16913
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.72| 18| 19| 119| 136| 1
---------------------------------------------------------------------------
119- 136 (34.01/22.33) EEYYSSSY.SLC.DSNDLPL
138- 157 (23.71/13.58) EAYWRQDFaTLSpESLSMPL
---------------------------------------------------------------------------
|