<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16901
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MYVMHNSEYPLSCFALFENGPCLIADANFDILMVKLKGFFQNAKANKIESRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVIANDCWNLLMEFMQSFMGSHAPGVPSVFGTKHDSVYGPADTMVQYMELFNKIRKQQQVPVAGIR |
Length | 150 |
Position | Head |
Organism | Columba livia (Rock dove) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Archelosauria> Archosauria> Dinosauria> Saurischia> Theropoda>
Coelurosauria> Aves> Neognathae> Columbiformes> Columbidae> Columba.
|
Aromaticity | 0.12 |
Grand average of hydropathy | 0.003 |
Instability index | 38.02 |
Isoelectric point | 6.81 |
Molecular weight | 16796.31 |
Publications | PubMed=23371554
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16901
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.72| 20| 37| 65| 84| 1
---------------------------------------------------------------------------
65- 84 (37.30/27.18) GTVTMG.PSARGISVEVEYGP
104- 124 (35.42/25.49) GSHAPGvPSVFGTKHDSVYGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.88| 19| 60| 22| 40| 2
---------------------------------------------------------------------------
22- 40 (33.76/26.94) CLIADANFDILMVKLKGFF
85- 103 (38.12/31.28) CVIANDCWNLLMEFMQSFM
---------------------------------------------------------------------------
|