Description | Uncharacterized protein (Fragment) |
Sequence | LAELEKVFEIAVKGSEEEKISAATILCGASLLQGWSVQEHTVDFITRLLSPPKPADYTGDDSYLIAHAPMLNVLIVGIGSVDCVQVFSLHGL |
Length | 92 |
Position | Tail |
Organism | Punica granatum (Pomegranate) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Lythraceae> Punica. |
Aromaticity | 0.07 |
Grand average of hydropathy | 0.402 |
Instability index | 22.79 |
Isoelectric point | 4.59 |
Molecular weight | 9867.24 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16890 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) LAELEKVFEIAVK 2) VDFITRLLSPPKP 3) YTGDD | 1 42 57 | 13 54 61 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab