<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16886
Description |
Uncharacterized protein |
Sequence | MEMKILEALNYYLVVFHPYRSLAQFLQDAGQSDLTQFTWGLVNDTYKMDLILIHPPHLIALACIYIASVFKDRDTTAWFEELRVDMNVVKNISMEILDFYENHRMITEERISAAFNKLALKP |
Length | 122 |
Position | Kinase |
Organism | Punica granatum (Pomegranate) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
Aromaticity | 0.12 |
Grand average of hydropathy | 0.067 |
Instability index | 38.76 |
Isoelectric point | 5.24 |
Molecular weight | 14317.48 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16886
No repeats found
No repeats found
|