<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16883
| Description |
Uncharacterized protein |
| Sequence | MDSEGNKFGRGPRELTGAVDLISHFKLLPHHDFFCKRSLPLSISDTHYLHDVVGETEIRKGEGMQLDQLVQNAVHSREYTNRIQPFDIDSLKDAFPLRESIPVDLPLAEKGLPTISGKPKSESKDKEKKHKKHKDRDKDKDREHKKHKHRHKDKSKDKEKEKKKEKGGHRDPGVDSSKKHHEKKRKHEGDEGLNNQGPRKSKS |
| Length | 203 |
| Position | Head |
| Organism | Punica granatum (Pomegranate) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.522 |
| Instability index | 29.34 |
| Isoelectric point | 9.56 |
| Molecular weight | 23430.12 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16883
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.98| 15| 15| 125| 139| 1
---------------------------------------------------------------------------
125- 139 (29.23/12.39) DKEKKHKK..HKDRDKD
159- 175 (21.76/ 7.34) EKEKKKEKggHRDPGVD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.85| 11| 33| 142| 152| 2
---------------------------------------------------------------------------
142- 152 (20.44/ 8.06) REHKKHKHRHK
178- 188 (19.41/ 7.30) KKHHEKKRKHE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.61| 12| 15| 85| 96| 3
---------------------------------------------------------------------------
85- 96 (21.68/11.47) PFDIDSLKDAFP
102- 113 (20.93/10.89) PVDLPLAEKGLP
---------------------------------------------------------------------------
|