<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16878
Description |
Uncharacterized protein |
Sequence | MGDGNGRGMANPNSSKHGNRPEWLQQYDLIGKIGEGTYGLVFLARIKAPSPNRGKFIAIKKFKQSKDGDGVSPTAIREIMLLREISHENVVKLVNVHINHADMSLYLAFDYAEHDLYEIIRHHRDKAGGQPINPYTVKSLLWQLLNGLNYLHSNWIIHRDLKPSNILVMGEGEEQGVVKIADFGLARIYQAPLKPLYENGVVVTIWYRAPELLLGAKHYTSAVDMWAVGCIFAELITLKPLFQGQEVKATQNPFQLDQLDKIFKVLGNYACPYLFYETNGIGSVVPLPPKSPAFDLLSRMLEYVFHFLSY |
Length | 310 |
Position | Kinase |
Organism | Punica granatum (Pomegranate) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.146 |
Instability index | 29.97 |
Isoelectric point | 8.33 |
Molecular weight | 35012.02 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16878
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 168.52| 32| 44| 167| 198| 1
---------------------------------------------------------------------------
80- 118 (38.62/22.33) MLLREISHENVVKLvnvhinhADMSLYLAFDY..AEHDL.YE
119- 151 (39.87/23.27) IIRHHRDKAGGQPI.......NPYTVKSLLWQ..LLNGLnYL
167- 198 (49.97/30.83) LVMGEGEEQGVVKI.......ADFGLARIYQA..PLKPL.YE
212- 243 (40.07/23.42) LLLGAKHYTSAVDM.......WAVGC..IFAEliTLKPL.FQ
---------------------------------------------------------------------------
|