<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16875
Description |
Uncharacterized protein |
Sequence | MPSNYLWMHVEALEILLQGLCGVQKERLRIHELHLKSGPNLGAVPSDLKILCDLEQPEPTWCFF |
Length | 64 |
Position | Head |
Organism | Punica granatum (Pomegranate) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
Aromaticity | 0.08 |
Grand average of hydropathy | 0.009 |
Instability index | 68.25 |
Isoelectric point | 5.42 |
Molecular weight | 7358.56 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16875
No repeats found
No repeats found
|