<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16868
Description |
Uncharacterized protein |
Sequence | MEEKNLMSRSATIITSPKSTQELAVEGQRHLEETVEAAFHVLTSMKDELCNPALWSSSSSSSNGHPVLPINSGNGDSSSDSTYHPDNTSGSGGGVAGGGGGALEEARLRYKSCVSALRAVLSAIPNSQKELEKKNYYLKLLIDQLRDLIADTSTWQSPCSA |
Length | 161 |
Position | Head |
Organism | Punica granatum (Pomegranate) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.454 |
Instability index | 53.26 |
Isoelectric point | 5.33 |
Molecular weight | 17128.79 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16868
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.11| 17| 17| 59| 75| 1
---------------------------------------------------------------------------
59- 75 (32.71/16.12) SSSSNGHPVLPINSGNG
78- 94 (33.40/16.57) SSDSTYHPDNTSGSGGG
---------------------------------------------------------------------------
|