<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16859
| Description |
Mediator of RNA polymerase II transcription subunit 14 |
| Sequence | MAAELGQQTVDFSTLVGRAAEESFLSLKELVEKSKSTDQSDTEKKINLLKYLSRTQQRMLKLNVLAKWCQQVPLIQYCQQLTSTLSSHATCFTQAADSLFFMHEGLQQARAPAYDVPSAIQVLLTGNYRRLPKCIEDVGAQGVLNHNEQKPVLKKLDTLVRSKLLEISIPKEFSGVKVSDGAVLLRVDGEFKVLVTLGYRGHLSLWRILHLELLVGEKSGPIKLEESRRHVLGDDLERRMAAAENPFATLYSVLNELCVALTMDTVTRQVQGLRRGRWKDAIRFEFVMDGNSSLAGSSSSQLNQDGEVDSASLRTPGLKIMYWLDFGKGSGASDPASCPSIKIEPGPDLQIKCLHSTFVLDPLTGKEAEFSLDQSCIDVEKLLLRAIFCNRYTRLLEIQKELSKNSQICRSVGDVKLQPLVGELDVNYKKKDGKVSAMEYEGQEVLCVRAYGSSFFALGINIRNGRFLLQSSQNILPPSSLSECEEALNQGSMTAAEVFIRLRTNSILNLFSSTGRFLGLKVYEDNSAAVKIPKNVATDSTMLLLGFPDCGTSYFLLMQLDKEFKPQFKLLETRSNLSGKAPSGDNHVTCIKKIDMDEMQLPEDELNFGLLDSGKLQSFLPNAGGLNQSTEHGLLSDVSLEGSGLATVGTTSSFSSVVDEVFDLEKGTSLPPFSVQNFSSSYNASASQYGSNPPNFQSMKTGSPSPKWEGGMQVSQVNKVSGGGRLYPPSNMSGSVRSVTSLSAGSGRPASAKRISTSKSEQDLASLRSPHSAEVGPYPSMDEDQLRFLTDSSKDTLSGNRSYRMLSPPRTTGTRSPAPSGKLSGPRTAPNGSAPGSVKALSSSPWVTTPVCKILYNNI |
| Length | 859 |
| Position | Tail |
| Organism | Punica granatum (Pomegranate) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.282 |
| Instability index | 43.06 |
| Isoelectric point | 8.03 |
| Molecular weight | 93716.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:UniProtKB-UniRule
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16859
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 208.04| 49| 54| 658| 707| 4
---------------------------------------------------------------------------
658- 687 (35.50/13.48) ................................VDEVFDLEKGTS..L.PPFSVQNFSSSYNASAS
688- 741 (61.70/32.85) QYGSNPPNfQSMKTGSPSPK......weggmqVSQVNKVSGGGR..LyPP...SNMSGSVRSVTS
743- 792 (64.39/30.49) SAGSGRPA..SAKRISTSKS............EQDLASLRSPHSaeV.GPYPSMDEDQLRFLTDS
793- 844 (46.44/20.06) SKDTLSGN.RSYRMLSP.PRttgtrspapsgkLSGPRTAPNGSA.....PGSVKALSSS......
---------------------------------------------------------------------------
|