<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16858

Description Uncharacterized protein
SequenceMEALDIPYVEEVGLRNASSNVWFRLPFTRGDSWQYICLRLGRPGTMYWDVKINDQHFRDLWELQKGSGSTPWGSGVRIANTSDVDSHIRYDAEGVVLSYQSVEADSVKKLVADIQRLSNARMFALGMRKLLGVKADDKQEDSTNADSKSPVGSKGVETSDKFSEQMRRVFRIEAVGLMSLWFSFGSGSGSGVLARFVVEWESGKEGCTMHVSPDQLWPHTKFLEDFINGGEVVSLLDCIRLTAGPLHSLAAATRPARATPVTAGPGVAAALSSMSKQGLLSSNVSSNINQSTATPAGNPMLSSGTAPPPGIQNLQGAAMLAAAGRGGPGIVPSSLLPIDVSVVLRGPYWIRIVYRKNFAVDMRCFAGDQVWLQPATPPKGGPSVGGSLPCPQFRPFIMEHVAQELNGIEPSFTGGPQNVVPANSNAPNMGSGQQLSMANGNRVNLSAAAAAISRSGPQVSSLNRVGPAHPGSPNLGAVGPALPIRRSPGAGVPPHVRGELNTAIIGLGDDGGYGGGWVPLVALKKVLRGILKYLGVLWLFAQLPDLLKEILGSILKDNEGALLNLDQEQPALRFFVGGYVFAVSVHRVQLLLQVLSVKRFHQQQQQQQQQQQNSSAAQDELTQAEIGEICDYFSRRVASEPYDASRVASFITLLTLPISVLREFLKLIAWKKGLVQAQGGEIAPAQKPRIELCLENHAGLTDNAENPSLSKSNIHYDRPRSSVDFALTVVLDPAHIPHINAAGGAAWLPYCVSVRLRYSFMENASVSFLRMEGSHGGRACWPSNEEWQKCKQRVARTVEGFSSGGDITQGRLRGVADNVQRTLHLCLQGLRDGGGATASSGAT
Length843
PositionTail
OrganismPunica granatum (Pomegranate)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Lythraceae> Punica.
Aromaticity0.07
Grand average of hydropathy-0.152
Instability index46.90
Isoelectric point8.73
Molecular weight90540.89
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16858
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      57.51|      15|      18|     297|     311|       1
---------------------------------------------------------------------------
  297-  311 (30.12/12.98)	GNPMLSSGTAPPPGI
  316-  330 (27.39/11.21)	GAAMLAAAGRGGPGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.07|      18|      22|     517|     537|       2
---------------------------------------------------------------------------
  514-  532 (29.07/26.17)	GGGWV....PLVaLKKVLRGILK
  535-  556 (27.01/11.54)	GVLWLfaqlPDL.LKEILGSILK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      30.08|       9|      18|     242|     252|       3
---------------------------------------------------------------------------
  242-  252 (12.41/13.05)	TAGPlhSLAAA
  262-  270 (17.68/ 9.48)	TAGP..GVAAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.61|      13|     118|      60|      76|       4
---------------------------------------------------------------------------
   60-   76 (18.06/17.08)	LWeLQKGSGStpwGSGV
  180-  192 (28.56/11.56)	LW.FSFGSGS...GSGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.51|      11|      23|     431|     443|       5
---------------------------------------------------------------------------
  431-  443 (15.89/13.65)	SGQQLSmaNGNRV
  455-  465 (19.62/ 9.45)	SGPQVS..SLNRV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.07|      22|     315|     491|     512|       8
---------------------------------------------------------------------------
  491-  512 (41.17/23.65)	GVPPHVRGELNTAIIGLGDDGG
  814-  835 (40.90/23.45)	GVADNVQRTLHLCLQGLRDGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     101.35|      36|     315|     335|     379|       9
---------------------------------------------------------------------------
  335-  379 (42.96/59.48)	LLPIDVSvVLRGpyWIR.IVYRKNFaVDMRcfaGDQVwlQPATPPK
  653-  689 (58.40/37.31)	LLTLPIS.VLRE..FLKlIAWKKGL.VQAQ...GGEI..APAQKPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      91.51|      27|     745|       6|      49|      12
---------------------------------------------------------------------------
    6-   33 (48.80/56.32)	IPYVEEVGLR.....NASSNvWFRLPFTRGD..SW
  748-  781 (42.71/15.42)	LPYCVSVRLRysfmeNASVS.FLRMEGSHGGraCW
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16858 with Med14 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GIEPSFTGGPQNVVPANSNAPNMGSGQQLSM
407
437










Molecular Recognition Features






MoRF SequenceStartStop




NANANA