<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16849
| Description |
Uncharacterized protein |
| Sequence | MSEDTGGGAVEFERSVMETLKRCEDRRDAPLVWAVEVAKCVGAADMELPSPELGQVLVSRLCSNFGNPFLWKFLDQALASRLVSSFHVLALLSPRILSDRQSQPEAYKLFLELISRYIFSYEAVSTDACKDK |
| Length | 132 |
| Position | Tail |
| Organism | Punica granatum (Pomegranate) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.033 |
| Instability index | 51.47 |
| Isoelectric point | 5.02 |
| Molecular weight | 14763.77 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16849
No repeats found
No repeats found
|