<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16840

Description Uncharacterized protein
SequenceMAGHQSSETAPNLLVNCIWSSISGDKVGNGTKSWTNLFGSGCSQSLVFHSPVEVSGRKIAKPPREVIERGKNQWQNCLIGWFVGSTPDFKQVTSTVNMLWENTVRVSTRGQLYIFKFSDGETLNWVLESGPWHVGHIPLILQRWCTELSVGKADFRKIPVWVILRNIPMHLYDCTGISYIASVVGKPLYMDKGTAQQTHLDFAKVCVEIDFEDEIPAEIMLDCGDDFVVGISVSIPWVPEKCSKCRVFGHNCLRQQQSSLQRDMQQRLQASGSVLQPTQNMMDQQNQLYRNQRGLAEASSMPLYSTAQAGQANGGDWQEEIYQRIKSLKDFYLQDLNEMYQKIATKLQQHDSLPQHPRSEQLEKLILFKVMLERLIAMLQVPKSEIYPGLKEKLPSYEKQIVQFLNTNRPRRQQGQLPPHHMPSVQPQQ
Length429
PositionTail
OrganismPunica granatum (Pomegranate)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Myrtales> Lythraceae> Punica.
Aromaticity0.08
Grand average of hydropathy-0.419
Instability index47.72
Isoelectric point8.25
Molecular weight48860.41
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
chromatin DNA binding	GO:0031490	IEA:InterPro
transcription coactivator activity	GO:0003713	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP16840
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     153.77|      44|      63|     318|     361|       1
---------------------------------------------------------------------------
  318-  361 (75.56/44.84)	QEEIYQRIKSLKDFYLQDLNEMYQKIATKLQQHDSLPQHPRSEQ
  383-  426 (78.21/46.64)	KSEIYPGLKEKLPSYEKQIVQFLNTNRPRRQQGQLPPHHMPSVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.95|      24|      27|     255|     278|       3
---------------------------------------------------------------------------
  255-  278 (40.98/24.47)	QQQSSLQRDMQQRLQASGSVLQPT
  283-  306 (41.97/25.21)	DQQNQLYRNQRGLAEASSMPLYST
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP16840 with Med15 domain of Kingdom Viridiplantae

Unable to open file!