<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16839
Description |
Uncharacterized protein |
Sequence | MAFLAFLSRHVQGVESSRPQEILVQANHVLKEEIREINKQLIDVVVDISDEDVDPTAAAAVAEGGEGVVSPIEPLRLLVPSNYPNCSPVLLDKFPVEVRLSQPMSLKDIARTWDNCSRAVILEYAEQSGGGSFSSKYGMGENIQTAT |
Length | 147 |
Position | Tail |
Organism | Punica granatum (Pomegranate) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Myrtales> Lythraceae> Punica.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.086 |
Instability index | 65.87 |
Isoelectric point | 4.61 |
Molecular weight | 16010.95 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16839
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.45| 20| 28| 73| 92| 1
---------------------------------------------------------------------------
73- 92 (37.39/28.74) EPLRLL.VPSNYPNCS.PVLLD
102- 123 (28.06/19.97) QPMSLKdIARTWDNCSrAVILE
---------------------------------------------------------------------------
|