<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16828
| Description |
Mediator of RNA polymerase II transcription subunit 22a |
| Sequence | MSKPPGAGSGPTAAAAAVAAQKQKTLLQRVDNDISNIVDNFSLLVNVARVNDPPVRNAQEAFQMEMRAARMVQAADSLLKLVSELKQTAIFSGFASLNENVDRHIAEFNQLEENTDRLLERIGEQAAGSLKELETHYYSSIERMSHQEG |
| Length | 149 |
| Position | Head |
| Organism | Apostasia shenzhenica |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Apostasioideae> Apostasia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.391 |
| Instability index | 38.13 |
| Isoelectric point | 5.20 |
| Molecular weight | 16340.15 |
| Publications | PubMed=28902843
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16828
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.73| 18| 19| 107| 125| 1
---------------------------------------------------------------------------
108- 125 (29.61/21.43) FNQLEENTDRLLERIGEQ
130- 147 (31.12/17.56) LKELETHYYSSIERMSHQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.61| 15| 18| 29| 43| 2
---------------------------------------------------------------------------
29- 43 (25.50/15.78) RV.DNDISNIVDNFSL
49- 64 (23.11/13.80) RVnDPPVRNAQEAFQM
---------------------------------------------------------------------------
|