<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16825

Description U-box domain-containing protein 52
SequenceMDGGGRLSTLHLTAVAIDKDKNSQHAVRWAIDHLINTSVIVLIHVRSKLSLTEASAEITRDQADAELNQLFLPYRGFCARKGMQLKEVVLEGADISKAIIDYINANHIQNIVCGTSNRSLIMKKFRNPDVSTCLIKSAPDHCAVYAISKGKPTTVRSGKNASPASATPPRQFGFPAIPSLLPDQEDLVRATYPRVRWRGSTPPTPLHERSERKSLDRLPDHMKTLSRDRPLTSARSVPNNLLMESLDAYNRPRRSVDYCDSFSDEIDIHEGLSFQSMDFGDSLEFSTTSTDSPNSNQSPLSGANRDLEAEMKRLKLELKQTMQMYSNACKEAITANQKAMELQQWKLEEARKFEELRHAEEAALAMAEMEKAKCKAAIEAAEVAQRIAELEAQKRINAELKARREAEEKKKALDALAHTDVRYRKYKIDEIEAATKNFAEENKIGEGGYGPVYKGYLDHTPVAIKVLRPDAAQGRKQFQQEVEVLSCIRHPNMVLLLGACPEYGCLVYEFMDYGSLDDRLFRRGNTPPIPWTVRFKIAAEIATALLFLHQTKPEPLVHRDLKPANILLDRNYVSKISDVGLARLVPPLVADNVTQYHMTSAAGTFCYIDPEYQQTGMLGVKSDVYSLGVMLLQIITAKVPMGLTHHVERAIEKGTFAQLLDPSITDWPVDEALAYAKIALKCAELRRKDRPDLGTIVLPELNRLRNLGHEYETTHHYNRTFSNNSSSSSSSTPPRAHNYSNSQARARSLMQQVFHSTLRLLAYIYI
Length766
PositionTail
OrganismApostasia shenzhenica
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae> Apostasioideae> Apostasia.
Aromaticity0.07
Grand average of hydropathy-0.430
Instability index40.68
Isoelectric point8.39
Molecular weight85999.15
Publications
PubMed=28902843

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16825
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.47|      20|      78|     139|     160|       1
---------------------------------------------------------------------------
  139-  160 (32.66/28.09)	PDHcaVYAISKGKP.TTVRSGKN
  219-  239 (33.81/21.09)	PDH..MKTLSRDRPlTSARSVPN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     110.45|      20|      20|     361|     380|       2
---------------------------------------------------------------------------
  322-  335 (16.84/ 6.96)	.....M.QMYSNACKEAITA
  337-  350 (16.87/ 6.99)	QKAM...ELQQWKLEEA...
  361-  380 (32.57/19.56)	EAALAMAEMEKAKCKAAIEA
  382-  398 (25.50/13.90)	EVAQRIAELEAQK...RINA
  400-  416 (18.68/ 8.44)	LKARREAE.EKKKALDAL..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.67|      13|     562|     162|     174|       3
---------------------------------------------------------------------------
  162-  174 (26.16/15.61)	SPASATPPRQFGF
  727-  739 (25.51/15.03)	SSSSSTPPRAHNY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.16|      17|      38|     418|     441|       4
---------------------------------------------------------------------------
  418-  436 (20.96/24.40)	HTDVrYRKYkIDEIEAATK
  449-  465 (32.20/12.78)	YGPV.YKGY.LDHTPVAIK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.98|      16|     324|     194|     209|       5
---------------------------------------------------------------------------
  194-  209 (33.52/22.11)	RVRWRGSTPPTPLHER
  519-  534 (33.46/22.05)	RLFRRGNTPPIPWTVR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.78|      10|      20|     254|     263|       6
---------------------------------------------------------------------------
  254-  263 (20.98/13.74)	RSVDYCDS..FS
  275-  286 (15.81/ 8.71)	QSMDFGDSleFS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16825 with Med32 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TYPRVRWRGSTPPTPLHERSERKSLDRLPDHMKTLSRDRPLTSARSVPNNLLMESL
191
246










Molecular Recognition Features






MoRF SequenceStartStop




NANANA