<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16814
| Description |
Mediator of RNA polymerase II transcription subunit 28 |
| Sequence | MEASKKLQLYFISLQHEHQSTKEEVLRKEISITEDELKTKSELIKKHELLIDAWSKESKQQLDKHIAELGRV |
| Length | 72 |
| Position | Head |
| Organism | Apostasia shenzhenica |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Apostasioideae> Apostasia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.806 |
| Instability index | 51.89 |
| Isoelectric point | 6.41 |
| Molecular weight | 8514.68 |
| Publications | PubMed=28902843
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16814
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.75| 16| 16| 12| 27| 1
---------------------------------------------------------------------------
12- 27 (26.42/13.55) ISLQHEHQSTKEEVLR
30- 45 (24.33/12.08) ISITEDELKTKSELIK
---------------------------------------------------------------------------
|