<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16805
| Description |
Mediator of RNA polymerase II transcription subunit 32 |
| Sequence | MMRRVDGVVGAYDDFLDAAWRVLRARGASGGRRSPECDAALQILNDKWDLFKASCDLAEGFVLTAQRDLLPMFAVPDDVMERTSTLAAVAPPNAAASTADDSAAVTDDR |
| Length | 109 |
| Position | Tail |
| Organism | Apostasia shenzhenica |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Apostasioideae> Apostasia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.106 |
| Instability index | 47.36 |
| Isoelectric point | 4.44 |
| Molecular weight | 11704.03 |
| Publications | PubMed=28902843
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transferase activity GO:0016740 IEA:UniProtKB-KW
|
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16805
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.62| 10| 26| 16| 25| 1
---------------------------------------------------------------------------
16- 25 (17.22/ 8.18) LDAAWRVLRA
44- 53 (18.40/ 9.10) LNDKWDLFKA
---------------------------------------------------------------------------
|