<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16801
| Description |
Putative mediator of RNA polymerase II transcription subunit 36b |
| Sequence | MATAVRCTDGGGRGGGFRGRSDGGGGRGRGRGGGGRGEGRGGGRGRGGGGGGRGGGRGRGGRGGMKGGSRVVVQPHRHDGVFVAKGKEDALCTKNMVPGESVYGEKRISVQNEDGTKVEYRVWNPFRSKLAAAILGGVDSIWIVPGSRVLYLGAASGTTVSHVSDIVGPNGLVYAVEFSPRSGRDLVNMAKKRTNVIPIIEDARHPTKYRMLVGMVDVIFSDVAQPDQARILALNASFFLKNGGHFVISIKANCIDSTVPAEAVFAQEVKKLQAEQFKPFEQVTLEPFERDHACVVGGYRMPKKQKQAS |
| Length | 309 |
| Position | Unknown |
| Organism | Apostasia shenzhenica |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae>
Apostasioideae> Apostasia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.381 |
| Instability index | 37.42 |
| Isoelectric point | 10.14 |
| Molecular weight | 32607.72 |
| Publications | PubMed=28902843
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | methyltransferase activity GO:0008168 IEA:UniProtKB-KW
RNA binding GO:0003723 IEA:UniProtKB-KW
|
| GO - Biological Process | methylation GO:0032259 IEA:UniProtKB-KW
rRNA processing GO:0006364 IEA:UniProtKB-KW
|
Interaction
Repeat regions
| Repeats |
>MDP16801
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.48| 10| 46| 11| 21| 3
---------------------------------------------------------------------------
11- 21 (18.29/ 8.77) GGRgGGFRGRS
60- 69 (22.19/ 6.84) GGR.GGMKGGS
---------------------------------------------------------------------------
|