<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16798

Description U-box domain-containing protein 34
SequenceMRRNGSQLRASVGRDDTSGVPQLVAVAVDCDKNSQHALKWAADHVLSKNEIFVLLHIRRKITAIPTPSGIQIPITEVGDDVASTFLEQIDLQTKELLLPFQCFCSRRGLQCKEVILEDSDVPKAIADFVTYQSVDKLVLGASSRNLFMRTIKSLDVPLSVSKIAPEFCSVYVISKGKVSSVRPATHPRKNYVNKFQQIDATGNRFQSVKSTPEVGQNFEVSKSCESVRGVKVRYDRTYDNRVSEGTTAGSQHGGHPETLYHSIASCPSPSRPPVEYLENIYLREFVDSRGKLSPLSTFLNEYNYRGEQNRSFESKGYGNCWSDGFGSSCHENYPPVSQREAGSWLGNPNGNPGHSYVGITNSKLLAEEVIVASESTPAKMRSIFPLLESPQASKMSGTTTPAKQRSILPLPESPQSSKMFGATTPFKQRSMIPLLESPQATKMANETGNKYNTDHTWRQEMSEMKKELETISSDIRYRRYGADEIQKATENFSDLLKIGEGGYGPVFKSTLDHTLVAIKILRSDVAQGMKQFHKEVEVLSCIRHPNMVLLLGACPEFGCLVYEYMSNGSLEDRLFCSGGSPPLSWQLRFKIAAEVATGLLFLHQAKPEPLVHRDLKPGNILLDCNFVGKIADVGLARLLPPPVSGNSTQYHMTAAAGTFCYIDPEYQKTGMVSTKSDIYALGIILLQIITAREPMGLAHNIENAMENGDFHQMLDPNVQDWPLEATMKLATIGLKCAELRRRDRPDLATVVLPQLNDLRTLAESTFEPSWSNSSWNLRSLRVHK
Length784
PositionTail
OrganismApostasia shenzhenica
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Asparagales> Orchidaceae> Apostasioideae> Apostasia.
Aromaticity0.08
Grand average of hydropathy-0.361
Instability index50.23
Isoelectric point8.03
Molecular weight87090.18
Publications
PubMed=28902843

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein serine kinase activity	GO:0106310	IEA:UniProtKB-EC
protein threonine kinase activity	GO:0106311	IEA:UniProtKB-EC

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP16798
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     123.59|      22|      22|     385|     406|       1
---------------------------------------------------------------------------
  376-  399 (41.31/30.00)	TPAKMRSifPLLESPQASKMSGTT
  400-  423 (41.98/30.63)	TPAKQRSilPLPESPQSSKMFGAT
  424-  447 (40.30/29.06)	TPFKQRSmiPLLESPQATKMANET
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.76|      30|     311|     334|     363|       2
---------------------------------------------------------------------------
  334-  363 (56.40/25.03)	PPVSQREAGSWLGNPNG.....NPGHSYVGITNSK
  641-  675 (48.35/20.69)	PPVSGNSTQYHMTAAAGtfcyiDPEYQKTGMVSTK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     148.53|      41|     286|     255|     296|       3
---------------------------------------------------------------------------
  255-  296 (71.14/46.59)	HPeTLYHSIASCPSPSRPPVEYLENIYLREFVDSRGKLSPLS
  544-  584 (77.39/46.55)	HP.NMVLLLGACPEFGCLVYEYMSNGSLEDRLFCSGGSPPLS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16798 with Med32 domain of Kingdom Viridiplantae
Unable to open file!