<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16781
Description |
Uncharacterized protein |
Sequence | MSNDEQLSLQRQVEAVLTRFRSELKTFMQHIRTANPSDGESQADLLSKLDPVFAVDKELQDAFRKELSNRKKEISALIDQAFAAIVSAKAKVKEEQAKLEMLQHIETDGFDMPTILALAERVSLTVGPPEGWQQDQPLVLHRPPYPTEDLMRSSRLFQVINVGVVEDVSRDAPTTKDGARRQSRVAQDHDMDLSLLELDLNPDLL |
Length | 205 |
Position | Middle |
Organism | Paramicrosporidium saccamoebae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Cryptomycota>
Cryptomycota incertae sedis> Paramicrosporidium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.472 |
Instability index | 57.37 |
Isoelectric point | 4.92 |
Molecular weight | 23130.94 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP16781
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.82| 12| 35| 126| 137| 1
---------------------------------------------------------------------------
126- 137 (25.95/15.88) VGPPEGWQQDQP
162- 173 (20.87/11.63) VGVVEDVSRDAP
---------------------------------------------------------------------------
|