<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16767
| Description |
Mediator of RNA polymerase II transcription subunit 17 |
| Sequence | MDKKILIEPRIEPPAFDVTNQGEEIYLPKQTPTERLSKQVKKLWQERDFRNLTIESLEKGESSEKKESKADDKATNLSVMKNTIKDAVAASHNDIGIGIDSLLNFKLMLGMKRKQLKHAAGIISSAAKKLGNIVEKERTFWNEAVSLREHHWTLQRGGGKEKNVGLQIFVSYGYQLAGSSFMENTAAQILRSSDEKQIAISLPQKAKGIVKLRLRKSSEAPGYDGPRVQENSLLRFESIEGSNIHQQLLAAQEAVFEAELFEQLVKEARVMTNASVILLENEVCLQVYPGVDLTIQWANTDTIQEKEETRSTDDDWTSVLQTDNNFGRTISPEPSMCTVLKLAMDLLIRRSHRRNFIREQERVIQGSRGVHRDSGYGYAQILTQPLHLLKYHFFCIHLREILNSTTKPLRDGGVPVQIHFISNLSKGKELIEEVWKKIGNDKFSLFTGSVIVIIDYSHSIRFTLESPGTLTLHLSHMDMKTRNLTQFQELLTREIKLLLLRIVLENLNTLTGLNDIVTNAGKWYLDSPALMIYKDMPPAVPSSAFTKKKSSYDLNDLLKAEISGLNEEEKNNEWKPEYWRRPVKITIVDGYSPDKLAVKIEAALVDAKPELIIGANDKNIHREFGEMVYEFLVNLL |
| Length | 636 |
| Position | Head |
| Organism | Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina>
Glomeromycetes> Glomerales> Glomeraceae> Rhizophagus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.392 |
| Instability index | 42.03 |
| Isoelectric point | 7.27 |
| Molecular weight | 72282.04 |
| Publications | PubMed=30271968
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16767
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 200.72| 60| 129| 100| 159| 1
---------------------------------------------------------------------------
100- 159 (102.67/86.61) DSLLNFKLMLGMKRKQLKHAAGIISSAAKKLGNIVEKERTFWNEAVSLREHHWTLQRGGG
231- 290 (98.05/82.33) NSLLRFESIEGSNIHQQLLAAQEAVFEAELFEQLVKEARVMTNASVILLENEVCLQVYPG
---------------------------------------------------------------------------
|