Description | Mediator of RNA polymerase II transcription subunit 17 |
Sequence | MDKKILIEPRIEPPAFDVTNQGEEIYLPKQTPTERLSKQVKKLWQERDFRNLTIESLEKGESSEKKESKADDKATNLSVMKNTIKDAVAASHNDIGIGIDSLLNFKLMLGMKRKQLKHAAGIISSAAKKLGNIVEKERTFWNEAVSLREHHWTLQRGGGKEKNVGLQIFVSYGYQLAGSSFMENTAAQILRSSDEKQIAISLPQKAKGIVKLRLRKSSEAPGYDGPRVQENSLLRFESIEGSNIHQQLLAAQEAVFEAELFEQLVKEARVMTNASVILLENEVCLQVYPGVDLTIQWANTDTIQEKEETRSTDDDWTSVLQTDNNFGRTISPEPSMCTVLKLAMDLLIRRSHRRNFIREQERVIQGSRGVHRDSGYGYAQILTQPLHLLKYHFFCIHLREILNSTTKPLRDGGVPVQIHFISNLSKGKELIEEVWKKIGNDKFSLFTGSVIVIIDYSHSIRFTLESPGTLTLHLSHMDMKTRNLTQFQELLTREIKLLLLRIVLENLNTLTGLNDIVTNAGKWYLDSPALMIYKDMPPAVPSSAFTKKKSSYDLNDLLKAEISGLNEEEKNNEWKPEYWRRPVKITIVDGYSPDKLAVKIEAALVDAKPELIIGANDKNIHREFGEMVYEFLVNLL |
Length | 636 |
Position | Head |
Organism | Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Glomeromycotina> Glomeromycetes> Glomerales> Glomeraceae> Rhizophagus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.392 |
Instability index | 42.03 |
Isoelectric point | 7.27 |
Molecular weight | 72282.04 |
Publications | PubMed=30271968 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364140 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP16767 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 200.72| 60| 129| 100| 159| 1 --------------------------------------------------------------------------- 100- 159 (102.67/86.61) DSLLNFKLMLGMKRKQLKHAAGIISSAAKKLGNIVEKERTFWNEAVSLREHHWTLQRGGG 231- 290 (98.05/82.33) NSLLRFESIEGSNIHQQLLAAQEAVFEAELFEQLVKEARVMTNASVILLENEVCLQVYPG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LSKQVKKLW 2) MDKKILIEPRIEPPAFDVTNQGEEIYLPKQT | 36 1 | 44 31 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab