<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16733

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQHQIVQSPARLGLTNPNSPSLQNPNPNPSPTKFPTSATHHHLRSATPPTAPITTGTTACTSSTLLSLLPPLPRAQALLLQMASLASKLFEVSPNRSLWISAFRGSLPTFLSSQAQSQPPPPIDSSPSTIKEIIACFTSLQTQLFEAVAELQEILDLQDAKQKIAREIKAKDSAILAFANKIKEAERVLDILVDDYSDYRRPKRVKSEGGDGNDDDSGSCSTTVESRLNLSDILSYAHRISYTTFAPPEFGAGQGPLRGALPPAPQEEQMRASQLYTFADLDVGLPKVVETKEKTIEAIIEPPPLQPVDANPLKDLAGLLPPNITVPSGWKPGMPVELPKDFPLVPPPGWKPGDAVPLPSLDALPMPRIEEQQLRPVPPQGLHKPPEPIQVRHVELDILDQDDDSSDYSSEEGSSEDDG
Length420
PositionMiddle
OrganismCitrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
Aromaticity0.05
Grand average of hydropathy-0.412
Instability index77.34
Isoelectric point4.88
Molecular weight45500.92
Publications
PubMed=29259619

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP16733
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.42|      14|      19|     322|     340|       1
---------------------------------------------------------------------------
  322-  340 (24.81/16.80)	PPnitvPsGWKPGMPVELP
  347-  360 (33.60/12.09)	PP....P.GWKPGDAVPLP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.14|      19|      20|      28|      46|       2
---------------------------------------------------------------------------
   28-   46 (35.71/16.98)	PNPSPTKFPTSA.THHHLRS
   49-   68 (27.42/11.39)	PPTAPITTGTTAcTSSTLLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      88.24|      22|      53|      71|      92|       3
---------------------------------------------------------------------------
   71-   92 (35.68/15.22)	PPLP.....RA.QAL....LLQMASLASKL..............FE
  120-  147 (29.55/11.47)	PPPPidsspSTiKEI....IACFTSLQTQL..............FE
  263-  302 (23.01/ 7.47)	PPAP.....QE.EQMrasqLYTFADLDVGLpkvvetkektieaiIE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.09|      15|      20|     363|     378|       5
---------------------------------------------------------------------------
  363-  378 (23.56/14.53)	DALPMPRiEEQQLRPV
  381-  395 (28.53/13.77)	QGLHKPP.EPIQVRHV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.56|      21|     206|     190|     216|       6
---------------------------------------------------------------------------
  190-  216 (35.35/37.99)	LDIL..VDDYSDYrrpkrvKSEGGDGNDD
  397-  419 (35.21/22.85)	LDILdqDDDSSDY......SSEEGSSEDD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP16733 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) PVELPKDFPLVPPPGWKPGDAVPLPSLDALPMPRIEEQQLRPVPPQGLHKPPEPIQVRHVELDILDQDDDSSDYSSEEGSSEDDG
2) VQSPARLGLTNPNSPSLQNPNPNPSPTKFPTSATHHHLRSATPPTAPITTGT
336
7
420
58










Molecular Recognition Features






MoRF SequenceStartStop




1) GLHKPPEPIQVRHVELDILDQDDDSSDYSSEEGSSEDDG
382
420