<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16709
| Description |
Uncharacterized protein |
| Sequence | MVISISRGTSLETGMAVNSVTQQKSYVREFAGADEDGAGRGTPTSTWADSTSGPRLNSAPTDGLILPFNRAGSPPRLSHLLDESRVISNRQLHPAAYRLYLEFLTRHAFSFASLVNGPNYDKIMNSIDDVLNLSQIFGLKVCESGVLLVEFVFSVVWQLLDASLDDEGLLEFASDKNFKWPTRPQDMEIDGIDGFIDKRSEHHEGLFRANTTMAIELIGEFLRNKVTSRILYLAHMNM |
| Length | 238 |
| Position | Tail |
| Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.171 |
| Instability index | 26.77 |
| Isoelectric point | 5.24 |
| Molecular weight | 26486.65 |
| Publications | PubMed=29259619
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16709
No repeats found
|