<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16703

Description Uncharacterized protein
SequenceMDPFSGSGSWNMMPSIPSHNSSPAASNQDNLFLSPQHQQQFYQQPTQFPQQQFQQQGRTPQQQQQPQQQQQQNQHHQSLASNFHLLHLMENLADAIENGTRDQQSDALVNELNNHFEKCQQLLSSISESLDTKAMTVEGQRRKLEESEQLLNQRKSVMLMLRVQLSCMLNTKFKVKDTDFCDCILRLRSVVGTSVSKL
Length198
PositionMiddle
OrganismCitrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
Aromaticity0.06
Grand average of hydropathy-0.831
Instability index65.88
Isoelectric point6.36
Molecular weight22728.18
Publications
PubMed=29259619

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP16703
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.45|      10|      30|      35|      44|       2
---------------------------------------------------------------------------
   35-   44 (21.55/ 8.67)	PQHQQQFYQQ
   66-   75 (20.90/ 8.21)	PQQQQQQNQH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.36|      15|      26|     109|     123|       3
---------------------------------------------------------------------------
  109-  123 (26.60/15.30)	VNELNNHFEKCQQLL
  137-  151 (23.76/13.03)	VEGQRRKLEESEQLL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP16703 with Med9 domain of Kingdom Viridiplantae

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MDPFSGSGSWNMMPSIPSHNSSPAASNQDNLFLSPQHQQQFYQQPTQFPQQQFQQQGRTPQQQQQPQQQQQQNQHHQSLAS
1
81

Molecular Recognition Features

MoRF SequenceStartStop
NANANA