<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16703
| Description |
Uncharacterized protein |
| Sequence | MDPFSGSGSWNMMPSIPSHNSSPAASNQDNLFLSPQHQQQFYQQPTQFPQQQFQQQGRTPQQQQQPQQQQQQNQHHQSLASNFHLLHLMENLADAIENGTRDQQSDALVNELNNHFEKCQQLLSSISESLDTKAMTVEGQRRKLEESEQLLNQRKSVMLMLRVQLSCMLNTKFKVKDTDFCDCILRLRSVVGTSVSKL |
| Length | 198 |
| Position | Middle |
| Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.831 |
| Instability index | 65.88 |
| Isoelectric point | 6.36 |
| Molecular weight | 22728.18 |
| Publications | PubMed=29259619
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16703
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.45| 10| 30| 35| 44| 2
---------------------------------------------------------------------------
35- 44 (21.55/ 8.67) PQHQQQFYQQ
66- 75 (20.90/ 8.21) PQQQQQQNQH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.36| 15| 26| 109| 123| 3
---------------------------------------------------------------------------
109- 123 (26.60/15.30) VNELNNHFEKCQQLL
137- 151 (23.76/13.03) VEGQRRKLEESEQLL
---------------------------------------------------------------------------
|