<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16701
| Description |
Uncharacterized protein |
| Sequence | MATPPPGANLDGAPPAAPPPPGTDMTGICFRDQLWLNTYPLDRNMIFDYFTLSLFYDRTCNNEQLRMRSIHPLDISQLSKMTGIEYMLSEVMEPHLFVIRKQKRDGPEKVTPMLTYYVLDGSIYQAPQLCNVFSARIGRALHYIQKAFTTAASKLEKIGYVDAENDGGTPLHSKAGKETIDLKEVKRVDQILASLQRKLPPAPPPPPFPEGYAPPQTEEAEKDPETQQTAEPQPPAIDPIIDQGPAKRMKI |
| Length | 251 |
| Position | Head |
| Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.513 |
| Instability index | 55.41 |
| Isoelectric point | 5.64 |
| Molecular weight | 28015.82 |
| Publications | PubMed=29259619
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP16701
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.03| 14| 29| 29| 42| 2
---------------------------------------------------------------------------
29- 42 (29.37/19.12) CFRDQLWLNT.YPLD
60- 74 (23.67/14.22) CNNEQLRMRSiHPLD
---------------------------------------------------------------------------
|