<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16700
| Description |
Uncharacterized protein |
| Sequence | MDPFSGSGSWNMMPSIPSHNSSPAASNQDNLFLSPQHQQQFYQQPTQFPQQQFQQQGRTPQQQQQPQQQQQQNQHHQSLASNFHLLHLMENLADAIENGTRDQQSDALVNELNNHFEKCQQLLSSISESLDTKAMTVEGQRRKLEESEQLLNQRKSVMLMLRVQLSCMLNTKFKVKDTDFCDCILRLRSVVGTSVMYNILGIEMALRPLFLQDICYLDPSHNICYLFKALDI |
| Length | 232 |
| Position | Middle |
| Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.608 |
| Instability index | 70.85 |
| Isoelectric point | 5.87 |
| Molecular weight | 26742.93 |
| Publications | PubMed=29259619
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP16700
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 33.67| 12| 15| 49| 61| 1
---------------------------------------------------------------------------
35- 59 (12.63/ 7.31) PQhqqqfyqqptqfPQQQfQQQGRT
60- 75 (21.03/ 8.53) PQ........qqqqPQQQ.QQQNQH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.36| 15| 26| 109| 123| 2
---------------------------------------------------------------------------
109- 123 (26.60/16.37) VNELNNHFEKCQQLL
137- 151 (23.76/13.93) VEGQRRKLEESEQLL
---------------------------------------------------------------------------
|