<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16694
Description |
Uncharacterized protein |
Sequence | MDDQEQQDQQHQVDQQMQSVQQQAEIEDMIACVNVMDDALLPCLTELDLNKALMPDFEAPLTDFDEPAVQPAVETELQASDDFPPPLDHQTDVEKHARNFMEAAKKLQEYFICLQRENKPTKAEILKREIDAMEEELKIKDVLVQKQEKVIQEWKKELRDRLDKHNAELERV |
Length | 172 |
Position | Head |
Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.842 |
Instability index | 61.60 |
Isoelectric point | 4.42 |
Molecular weight | 20126.44 |
Publications | PubMed=29259619
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16694
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.18| 26| 29| 109| 137| 2
---------------------------------------------------------------------------
109- 137 (33.92/28.47) EYFIclQRENK...PTKAEiLKREIDAMEEEL
141- 169 (38.26/20.71) DVLV..QKQEKviqEWKKE.LRDRLDKHNAEL
---------------------------------------------------------------------------
|