<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP16690
Description |
Uncharacterized protein |
Sequence | MDLGGKRFGTDACLIYFNSRDDFVKSWNGNHTRWIRIILHTEKKDSTGMTWNLGFFAGEGVVVVVPRREGRINALCTGPKELGGAIDLVNQFKLLHHHEFFCKRALPSSLSETHYLRNVVGDTEIRKGEGMELDQLFQTSSYVRQRDYSLCPSDLEVLGEAFRMRDLTPIDLPSVEKGIPTAVKPNSLSKDKEGQPRKHRVKYHGRNKHRHKYGISAENKKRGAHQYSVSEQLKNHLEKKRKHDGRGDLSVIHQNNGQITEKLLEFIKVSRNWDVDC |
Length | 277 |
Position | Head |
Organism | Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> malvids> Sapindales> Rutaceae> Aurantioideae> Citrus.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.735 |
Instability index | 32.31 |
Isoelectric point | 9.41 |
Molecular weight | 31775.74 |
Publications | PubMed=29259619
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP16690
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.33| 12| 14| 169| 180| 3
---------------------------------------------------------------------------
169- 180 (21.73/14.09) PIDLPSVEKGIP
185- 196 (21.60/13.96) PNSLSKDKEGQP
---------------------------------------------------------------------------
|